PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF155500010CFD_t1
Common NameTRAES_3BF155500010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 301aa    MW: 31737.5 Da    PI: 8.7905
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF155500010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.11.5e-3652108561
                   zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               l+cprCdstntkfCy+nnysl+qPr+fC++C ryWt+GGalrnvPvGgg+r+n k+
  TRAES3BF155500010CFD_t1  52 GLNCPRCDSTNTKFCYFNNYSLTQPRHFCRSCSRYWTRGGALRNVPVGGGCRRNTKR 108
                              679**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3236107IPR003851Zinc finger, Dof-type
PfamPF027018.1E-3153107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.85453107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MATAGAGSGA AGGGDDGCGG AVDGDCGGIG NKKSRSMSER ARLARLPQPV PGLNCPRCDS  60
TNTKFCYFNN YSLTQPRHFC RSCSRYWTRG GALRNVPVGG GCRRNTKRRA KPKVVSATSR  120
AAMVGTSSVT STMSSSTTYV TGTGTTPPRL QYPMFGSVPS HDSQFADSFD PANLGLIFPV  180
RLLLADSDAS AVDGCAQQHH HHAHGNGMEQ LSVAQDSFPF MYAMDHQMSG LSAQAMPITM  240
GTMQGMFHVG LQGIGGGNGD EIGGQQLHHP PAKRNHKQQD YPSSRDMYGD VVNANGGVGY  300
I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A080YUV80.0A0A080YUV8_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.19e-40OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]